DHSO_HUMAN Q00796
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q00796
Recommended name：Sorbitol dehydrogenase
EC number：EC:1.1.1.-
Alternative names：(SDH) ((R,R)-butanediol dehydrogenase) (L-iditol 2-dehydrogenase) (Polyol dehydrogenase) (Ribitol dehydrogenase) (RDH) (Xylitol dehydrogenase) (XDH)
Cleaved into：
GeneID：6652
Gene names (primary )：SORD
Gene names (synonym )：
Gene names (ORF )：
Length：357
Mass：38325
Sequence：MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Tissue specificity：Expressed in liver (PubMed:3365415). Expressed in kidney and epithelial cells of both benign and malignant prostate tissue. Expressed in epididymis (at protein level). {ECO:0000269|PubMed:16278369, ECO:0000269|PubMed:19423711, ECO:0000269|PubMed:20372835, ECO:0000269|PubMed:3365415}.
Induction：Up-regulated by androgens and down-regulated by castration. {ECO:0000269|PubMed:20372835}.
Developmental stage：
Protein families：Zinc-containing alcohol dehydrogenase family