DYL1_HUMAN   P63167


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63167

Recommended name:Dynein light chain 1, cytoplasmic

EC number:

Alternative names:(8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN)

Cleaved into:

GeneID:8655

Gene names  (primary ):DYNLL1

Gene names  (synonym ):DLC1 DNCL1 DNCLC1 HDLC1

Gene names  (ORF ):

Length:89

Mass:10366

Sequence:MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:8628263}.

Induction:Up-regulated by ATMIN, PAK1 and estrogen. {ECO:0000269|PubMed:15891768, ECO:0000269|PubMed:22167198}.

Developmental stage:

Protein families:Dynein light chain family


   💬 WhatsApp