CST9_HUMAN Q5W186
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5W186
Recommended name：Cystatin-9
EC number：
Alternative names：(Cystatin-like molecule)
Cleaved into：
GeneID：128822
Gene names (primary )：CST9
Gene names (synonym )：CLM CTES7A
Gene names (ORF )：
Length：159
Mass：18135
Sequence：MSSPQRRKAMPWALSLLLMGFQLLVTYAWCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
Tissue specificity：Expressed in heart, placenta, lung, liver, skeletal muscle and pancreas (PubMed:12535658). Not expressed in brain (PubMed:12535658). Expressed in epididymis, kidney, testis, spinal cord, and thymus with a strong expression in epididymis and kidney and a weak expression in the spinal cord and thymus (PubMed:20565543). {ECO:0000269|PubMed:12535658, ECO:0000269|PubMed:20565543}.
Induction：Up-regulated by bacterial lipopolysaccharides (LPS), in some cancer cells such as promyelocytic leukemia cells (HL-60) or myelomonocytic leukemia cells (U-937). {ECO:0000269|PubMed:12535658}.
Developmental stage：
Protein families：Cystatin family