ACER1_HUMAN Q8TDN7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TDN7
Recommended name：Alkaline ceramidase 1
EC number：EC:3.5.1.-
Alternative names：(AlkCDase 1) (Alkaline CDase 1) (Acylsphingosine deacylase 3) (N-acylsphingosine amidohydrolase 3)
Cleaved into：
GeneID：125981
Gene names (primary )：ACER1
Gene names (synonym )：ASAH3
Gene names (ORF )：
Length：264
Mass：31095
Sequence：MPSIFAYQSSEVDWCESNFQYSELVAEFYNTFSNIPFFIFGPLMMLLMHPYAQKRSRYIYVVWVLFMIIGLFSMYFHMTLSFLGQLLDEIAILWLLGSGYSIWMPRCYFPSFLGGNRSQFIRLVFITTVVSTLLSFLRPTVNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISDRLLCSFWQRIHFFYLHSIWHVLISITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC
Tissue specificity：Mainly expressed in epidermis. {ECO:0000269|PubMed:16477081, ECO:0000269|PubMed:17713573}.
Induction：Up-regulated by Ca(2+) (PubMed:17713573). Down-regulated by epidermal growth factor/EGF (PubMed:17713573). {ECO:0000269|PubMed:17713573}.
Developmental stage：
Protein families：Alkaline ceramidase family