CCRL2_HUMAN O00421
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O00421
Recommended name:C-C chemokine receptor-like 2
EC number:
Alternative names:(Chemokine receptor CCR11) (Chemokine receptor X) (Putative MCP-1 chemokine receptor)
Cleaved into:
GeneID:9034
Gene names (primary ):CCRL2
Gene names (synonym ):CCR11 CCR6 CKRX CRAM HCR
Gene names (ORF ):
Length:344
Mass:39513
Sequence:MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
Tissue specificity:Expressed abundantly in immunal tissues such as spleen, fetal liver, lymph node and bone marrow. Strong expression also in lung and heart. Expressed in almost all hematopoietic cells including monocytes, macrophages, PMNs, T-cells (both CD4+ and CD8+), monocyte-derived iDCs, NK cells, and CD34+ progenitor cells. B-cells expressed isoform 1 but not isoform 2. Up-regulated on synovial neutrophils of rheumatoid arthritis patients. {ECO:0000269|PubMed:11828366, ECO:0000269|PubMed:15188357, ECO:0000269|PubMed:18397265, ECO:0000269|PubMed:9473515}.
Induction:Up-regulated by CCL5 on the pre-B-cell lines NALM-6 and G2. {ECO:0000269|PubMed:18397265}.
Developmental stage:
Protein families:G-protein coupled receptor 1 family