NAT8_HUMAN Q9UHE5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UHE5
Recommended name：N-acetyltransferase 8
EC number：EC:2.3.1.-
Alternative names：(Acetyltransferase 2) (ATase2) (Camello-like protein 1) (Cysteinyl-conjugate N-acetyltransferase) (CCNAT)
Cleaved into：
GeneID：9027
Gene names (primary )：NAT8
Gene names (synonym )：CML1 GLA TSC501
Gene names (ORF )：
Length：227
Mass：25619
Sequence：MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL
Tissue specificity：Preferentially expressed in liver and kidney. Also detected in brain (at protein level). {ECO:0000269|PubMed:22267734, ECO:0000269|PubMed:9852678}.
Induction：Up-regulated by ceramides. {ECO:0000269|PubMed:19011241}.
Developmental stage：
Protein families：Camello family