LAT1L_HUMAN   Q9GIP4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9GIP4

Recommended name:Putative L-type amino acid transporter 1-like protein IMAA

EC number:

Alternative names:(hLAT1 3-transmembrane protein IMAA) (hLAT1 3TM IMAA) (hLAT1 3-transmembrane protein MMAA) (hLAT1 3TM MMAA)

Cleaved into:

GeneID:

Gene names  (primary ):SLC7A5P2

Gene names  (synonym ):IMAA MMAA

Gene names  (ORF ):

Length:190

Mass:19840

Sequence:MAGAGPKRRALAAPVAEEKEEAREKMMAAKRADGAAPAGEGEGVTLQGNITLLKGVAVIVVAIMSSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLDVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACHSVQLIVHQPTQVI

Tissue specificity:Expressed in peripheral blood mononuclear cells and lymphoid and myeloid cell lines. {ECO:0000269|PubMed:12009310}.

Induction:Up-regulated by concanavalin-A stimulation. {ECO:0000269|PubMed:12009310}.

Developmental stage:

Protein families:Amino acid-polyamine-organocation (APC) superfamily, L-type amino acid transporter (LAT) (TC 2.A.3.8) family


   💬 WhatsApp