RHOB_HUMAN P62745
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62745
Recommended name：Rho-related GTP-binding protein RhoB
EC number：
Alternative names：(Rho cDNA clone 6) (h6)
Cleaved into：
GeneID：388
Gene names (primary )：RHOB
Gene names (synonym )：ARH6 ARHB
Gene names (ORF )：
Length：196
Mass：22123
Sequence：MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
Tissue specificity：
Induction：Up-regulated by DNA damaging agents like H(2)O(2) or ionizing radiation (IR). {ECO:0000269|PubMed:21373644}.
Developmental stage：
Protein families：Small GTPase superfamily, Rho family