RHBL4_HUMAN Q8TEB9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TEB9
Recommended name：Rhomboid-related protein 4
EC number：EC:3.4.21.105
Alternative names：(RRP4) (Rhomboid domain-containing protein 1) (Rhomboid-like protein 4)
Cleaved into：
GeneID：84236
Gene names (primary )：RHBDD1
Gene names (synonym )：RHBDL4
Gene names (ORF )：HSD-50 HSD50
Length：315
Mass：35823
Sequence：MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCYQQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYLLLQFAVAEFMDEPDFKRSCAVGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVELVAIHLFSPGTSFAGHLAGILVGLMYTQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ
Tissue specificity：Expressed strongly in testis.
Induction：Up-regulated by endoplasmic reticulum stress agents that induce the unfolded protein response (UPR). {ECO:0000269|PubMed:22795130}.
Developmental stage：
Protein families：Peptidase S54 family