RHBL4_HUMAN   Q8TEB9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TEB9

Recommended name:Rhomboid-related protein 4

EC number:EC:3.4.21.105

Alternative names:(RRP4) (Rhomboid domain-containing protein 1) (Rhomboid-like protein 4)

Cleaved into:

GeneID:84236

Gene names  (primary ):RHBDD1

Gene names  (synonym ):RHBDL4

Gene names  (ORF ):HSD-50 HSD50

Length:315

Mass:35823

Sequence:MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCYQQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYLLLQFAVAEFMDEPDFKRSCAVGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVELVAIHLFSPGTSFAGHLAGILVGLMYTQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ

Tissue specificity:Expressed strongly in testis.

Induction:Up-regulated by endoplasmic reticulum stress agents that induce the unfolded protein response (UPR). {ECO:0000269|PubMed:22795130}.

Developmental stage:

Protein families:Peptidase S54 family


   💬 WhatsApp