DHB8_HUMAN Q92506
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q92506
Recommended name：Estradiol 17-beta-dehydrogenase 8
EC number：EC:1.1.1.62
Alternative names：(17-beta-hydroxysteroid dehydrogenase 8) (17-beta-HSD 8) (3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit) (KAR alpha subunit) (3-oxoacyl-[acyl-carrier-protein] reductase) (Protein Ke6) (Ke-6) (Really interesting new gene 2 protein) (Short chain dehydrogenase/reductase family 30C member 1) (Testosterone 17-beta-dehydrogenase 8)
Cleaved into：
GeneID：7923
Gene names (primary )：HSD17B8
Gene names (synonym )：FABGL HKE6 RING2 SDR30C1
Gene names (ORF )：
Length：261
Mass：26974
Sequence：MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Tissue specificity：Highly expressed in placenta, liver and pancreas, lower in the skeletal muscle and kidney. Widely expressed. {ECO:0000269|PubMed:17978863}.
Induction：Up-regulated by estradiol. {ECO:0000269|PubMed:18852215}.
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family