CRPAK_HUMAN   Q8N1N5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N1N5

Recommended name:Cysteine-rich PAK1 inhibitor

EC number:

Alternative names:(CRIPak)

Cleaved into:

GeneID:

Gene names  (primary ):CRIPAK

Gene names  (synonym ):

Gene names  (ORF ):

Length:446

Mass:48076

Sequence:MHEPSLCANVECPPAHTCPCGVPACSCAHVECPPAHTCRCGVPACSHMPMWSARLLTRAHVECPPAHTRVHVECPPAHVPMWSAHLLTCADVECHLLTHVPMWSARLLTCPCGVPACSHVPMRSARLLTRAHAECPPAHTCPCGVPACSHVPMRSARLLTRADVECPPAHTCPCGVPACSHVPTWSARLITRAHVECSPAHTCRCGVPACSHVPMWSVRLLTRADAECPPAHTCRCGVPACSHVPMWSARLLTCRCGVPACSHVPMWSARLLTCRCGVPACSHVPMWSARLLTRAHVECPPAHTCRRGVPACSRAHMECPPAHTCHCGVPACSHTCRCGVPACSHVPMWSARLLTRAHVECPPAHTRAHVECPPAHTCPCGVPACSHTCPCGVPACSHKALAWWFCRFPVLPAESDAVTVHSTHGGFLIRFYVKDPFYISLHLEIT

Tissue specificity:Widely expressed with a highest expression observed in trachea, prostate and adrenal glands. Expressed in many cancer cell lines including breast cancer cells. {ECO:0000269|PubMed:16278681}.

Induction:Up-regulated by estrogen. {ECO:0000269|PubMed:16278681}.

Developmental stage:

Protein families:


   💬 WhatsApp