TM100_HUMAN   Q9NV29


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NV29

Recommended name:Transmembrane protein 100

EC number:

Alternative names:

Cleaved into:

GeneID:55273

Gene names  (primary ):TMEM100

Gene names  (synonym ):

Gene names  (ORF ):

Length:134

Mass:14386

Sequence:MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATGGTELSCYRCIIPFAVVVFIAGIVVTAVAYSFNSHGSIISIFGLVVLSSGLFLLASSALCWKVRQRSKKAKRRESQTALVANQRSLFA

Tissue specificity:Expressed in neurons of the myenteric and submucosal plexuses in the gastric body, jejunum and proximal colon. Expressed in arterial endothelial cells and neurons of the central nervous system and peripheral nervous system. Expressed in umbilical artery endothelial cells (at protein level). {ECO:0000269|PubMed:22783020, ECO:0000269|PubMed:23485812}.

Induction:Up-regulated by GDF2/BMP9 and BMP10 (at protein level). {ECO:0000269|PubMed:22783020}.

Developmental stage:

Protein families:


   💬 WhatsApp