LYSM3_HUMAN   Q7Z3D4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7Z3D4

Recommended name:LysM and putative peptidoglycan-binding domain-containing protein 3

EC number:

Alternative names:

Cleaved into:

GeneID:116068

Gene names  (primary ):LYSMD3

Gene names  (synonym ):

Gene names  (ORF ):

Length:306

Mass:34538

Sequence:MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTETLCPPKGRQTSRHSSVQYSSEQQEILPANDSLAYSDSAGSFLKEVDRDIEQIVKCTDNKRENLNEVVSALTAQQMRFEPDNKNTQRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYYEILAKVDVSHHSTVDSSHLHSKITPPSQQREMENGIVPTKGIHFSQQDDHKLYSQDSQSPAAQQET

Tissue specificity:

Induction:Up-regulated by Golgi stress-inducing agent nigericin. {ECO:0000269|PubMed:29851555}.

Developmental stage:

Protein families:


   💬 WhatsApp