TRI52_HUMAN Q96A61
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96A61
Recommended name：E3 ubiquitin-protein ligase TRIM52
EC number：EC:2.3.2.27
Alternative names：(RING finger protein 102) (Tripartite motif-containing protein 52)
Cleaved into：
GeneID：84851
Gene names (primary )：TRIM52
Gene names (synonym )：RNF102
Gene names (ORF )：
Length：297
Mass：34653
Sequence：MAGYATTPSPMQTLQEEAVCAICLDYFKDPVSISCGHNFCRGCVTQLWSKEDEEDQNEEEDEWEEEEDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEEEEEEEEDQDYYLGGLRPDLRIDVYREEEILEAYDEDEDEELYPDIHPPPSLPLPGQFTCPQCRKSFTRRSFRPNLQLANMVQIIRQMCPTPYRGNRSNDQGMCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLPLEEVVQEYQEIKLETTLVGILQIEQESIHSKAYNQ
Tissue specificity：
Induction：Up-regulated by Golgi stress-inducing agents such nigericin, trichostatin, tetoposide, campothecin and brefeldin A (PubMed:31133683). Up-regulated by IL1B/interleukin-1 beta and TNFA/TNF-alpha (PubMed:28073078). {ECO:0000269|PubMed:28073078, ECO:0000269|PubMed:31133683}.
Developmental stage：
Protein families：TRIM/RBCC family