CITE1_HUMAN   Q99966


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99966

Recommended name:Cbp/p300-interacting transactivator 1

EC number:

Alternative names:(Melanocyte-specific protein 1)

Cleaved into:

GeneID:4435

Gene names  (primary ):CITED1

Gene names  (synonym ):MSG1

Gene names  (ORF ):

Length:193

Mass:19896

Sequence:MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMHLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC

Tissue specificity:Expressed only in melanocytes and testis.

Induction:Up-regulated by GPR39 in neuronal cells. {ECO:0000269|PubMed:21172805}.

Developmental stage:

Protein families:CITED family


   💬 WhatsApp