CLC6A_HUMAN Q6EIG7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6EIG7
Recommended name：C-type lectin domain family 6 member A
EC number：
Alternative names：(C-type lectin superfamily member 10) (Dendritic cell-associated C-type lectin 2) (DC-associated C-type lectin 2) (Dectin-2)
Cleaved into：
GeneID：93978
Gene names (primary )：CLEC6A
Gene names (synonym )：CLECSF10 DECTIN2
Gene names (ORF )：
Length：209
Mass：23998
Sequence：MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL
Tissue specificity：Expressed in lung, spleen, lymph node, leukocytes, bone marrow, tonsils and dendritic cells. Strongly expressed in purified monocytes and weakly in B-cells. In peripheral blood cells, preferentially expressed in plasmacytoids rather than myeloids. {ECO:0000269|PubMed:15175046, ECO:0000269|PubMed:15368084, ECO:0000269|PubMed:15810886}.
Induction：Up-regulated by granulocyte-macrophage colony-stimulating factor (GM-CSF), TGF-beta 1, TNF-alpha and down-regulated by IL-4, IL-10 or UVB in CD14+ monocytes. {ECO:0000269|PubMed:15810886}.
Developmental stage：
Protein families：