HEXI2_HUMAN Q96MH2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96MH2
Recommended name：Protein HEXIM2
EC number：
Alternative names：(Hexamethylene bis-acetamide-inducible protein 2)
Cleaved into：
GeneID：124790
Gene names (primary )：HEXIM2
Gene names (synonym )：
Gene names (ORF )：L3
Length：286
Mass：32419
Sequence：MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAPYNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT
Tissue specificity：Ubiquitously expressed with higher expression in testis. HEXIM1 and HEXIM2 are differentially expressed. {ECO:0000269|PubMed:15713661}.
Induction：Up-regulated by HMBA (hexamethylene bisacetamide) (at protein level). {ECO:0000269|PubMed:15713661}.
Developmental stage：
Protein families：HEXIM family