ABC3F_HUMAN Q8IUX4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8IUX4
Recommended name:DNA dC->dU-editing enzyme APOBEC-3F
EC number:EC:3.5.4.38
Alternative names:(Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F) (A3F)
Cleaved into:
GeneID:200316
Gene names (primary ):APOBEC3F
Gene names (synonym ):
Gene names (ORF ):
Length:373
Mass:45020
Sequence:MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE
Tissue specificity:Widely expressed. Highly expressed in ovary. {ECO:0000269|PubMed:11863358, ECO:0000269|PubMed:15152192, ECO:0000269|PubMed:20308164}.
Induction:Up-regulated by IFN-alpha.
Developmental stage:
Protein families:Cytidine and deoxycytidylate deaminase family