HLAA_HUMAN P04439
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04439
Recommended name:HLA class I histocompatibility antigen, A alpha chain
EC number:
Alternative names:(Human leukocyte antigen A) (HLA-A)
Cleaved into:
GeneID:3105
Gene names (primary ):HLA-A
Gene names (synonym ):HLAA
Gene names (ORF ):
Length:365
Mass:40841
Sequence:MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Tissue specificity:Ubiquitous. {ECO:0000305}.
Induction:Up-regulated by IFNG, and proinflammatory cytokines IL1B and TNF. {ECO:0000269|PubMed:21263072, ECO:0000269|PubMed:22245737}.
Developmental stage:
Protein families:MHC class I family