FCGRB_HUMAN Q92637
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q92637
Recommended name：High affinity immunoglobulin gamma Fc receptor IB
EC number：
Alternative names：(IgG Fc receptor IB) (Fc-gamma RIB) (FcRIB) (hFcgammaRIB)
Cleaved into：
GeneID：
Gene names (primary )：FCGR1B
Gene names (synonym )：IGFRB
Gene names (ORF )：
Length：280
Mass：32232
Sequence：MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFMEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISQYTVKGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWNLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT
Tissue specificity：
Induction：Up-regulated by IFNG/IFN-gamma. {ECO:0000269|PubMed:1402657, ECO:0000269|PubMed:1430234}.
Developmental stage：
Protein families：Immunoglobulin superfamily, FCGR1 family