TNF15_HUMAN   O95150


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O95150

Recommended name:Tumor necrosis factor ligand superfamily member 15

EC number:

Alternative names:(TNF ligand-related molecule 1) (Vascular endothelial cell growth inhibitor)

Cleaved into:Tumor necrosis factor ligand superfamily member 15, membrane form; Tumor necrosis factor ligand superfamily member 15, secreted form

GeneID:9966

Gene names  (primary ):TNFSF15

Gene names  (synonym ):TL1 VEGI

Gene names  (ORF ):

Length:251

Mass:28087

Sequence:MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Tissue specificity:Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon. {ECO:0000269|PubMed:11911831, ECO:0000269|PubMed:11923219, ECO:0000269|PubMed:9434163, ECO:0000269|PubMed:9872942}.

Induction:Up-regulated by IL1A/interleukin-1 alpha and TNF. {ECO:0000269|PubMed:11911831, ECO:0000269|PubMed:11923219}.

Developmental stage:

Protein families:Tumor necrosis factor family


   💬 WhatsApp