C1QT4_HUMAN Q9BXJ3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BXJ3
Recommended name：Complement C1q tumor necrosis factor-related protein 4
EC number：
Alternative names：(C1q/TNF-related protein 4)
Cleaved into：
GeneID：114900
Gene names (primary )：C1QTNF4
Gene names (synonym )：CTRP4
Gene names (ORF )：
Length：329
Mass：35256
Sequence：MLPLLLGLLGPAACWALGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRCRVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFSAARTRSLVGSDAGPGPRHQPLAFDTEFVNIGGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELL
Tissue specificity：Widely expressed at low levels (PubMed:21658842). Highest levels in adipocyte tissue and brain (PubMed:24366864). {ECO:0000269|PubMed:21658842, ECO:0000269|PubMed:24366864}.
Induction：Up-regulated by IL6. {ECO:0000269|PubMed:21658842}.
Developmental stage：
Protein families：