PA2GE_HUMAN Q9NZK7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NZK7
Recommended name:Group IIE secretory phospholipase A2
EC number:EC:3.1.1.4
Alternative names:(GIIE sPLA2) (sPLA2-IIE) (Phosphatidylcholine 2-acylhydrolase 2E)
Cleaved into:
GeneID:30814
Gene names (primary ):PLA2G2E
Gene names (synonym ):
Gene names (ORF ):
Length:142
Mass:15989
Sequence:MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC
Tissue specificity:Restricted to the brain, heart, lung, and placenta. {ECO:0000269|PubMed:10681567}.
Induction:Up-regulated by inflammatory cytokine IL1B. {ECO:0000269|PubMed:11922621}.
Developmental stage:
Protein families:Phospholipase A2 family