DNSL2_HUMAN Q92874
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q92874
Recommended name:Deoxyribonuclease-1-like 2
EC number:EC:3.1.21.-
Alternative names:(DNase I homolog protein DHP1) (Deoxyribonuclease I-like 2) (DNase I-like 2)
Cleaved into:
GeneID:1775
Gene names (primary ):DNASE1L2
Gene names (synonym ):DHP1 DNAS1L2
Gene names (ORF ):
Length:299
Mass:32853
Sequence:MGGPRALLAALWALEAAGTAALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQEVRDPDLSAVSALMEQINSVSEHEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPDPEDVFSREPFVVKFSAPGTGERAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAEIDALYDVYLDVIDKWGTDDMLFLGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLKFHR
Tissue specificity:Preferentially expressed in the skin and up-regulated during keratinocytes differentiation. Highly abundant (at protein level) in the stratum granulosum. {ECO:0000269|PubMed:16902420}.
Induction:Up-regulated by inflammatory cytokines. {ECO:0000269|PubMed:15203207}.
Developmental stage:
Protein families:DNase I family