THIO_HUMAN   P10599


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P10599

Recommended name:Thioredoxin

EC number:

Alternative names:(Trx) (ATL-derived factor) (ADF) (Surface-associated sulphydryl protein) (SASP) (allergen Hom s Trx)

Cleaved into:

GeneID:7295

Gene names  (primary ):TXN

Gene names  (synonym ):TRDX TRX TRX1

Gene names  (ORF ):

Length:105

Mass:11737

Sequence:MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Tissue specificity:

Induction:Up-regulated by ionizing radiation. {ECO:0000269|PubMed:11118054}.

Developmental stage:

Protein families:Thioredoxin family


   💬 WhatsApp