REG4_HUMAN Q9BYZ8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BYZ8
Recommended name：Regenerating islet-derived protein 4
EC number：
Alternative names：(REG-4) (Gastrointestinal secretory protein) (REG-like protein) (Regenerating islet-derived protein IV) (Reg IV)
Cleaved into：
GeneID：83998
Gene names (primary )：REG4
Gene names (synonym )：GISP RELP
Gene names (ORF )：
Length：158
Mass：18230
Sequence：MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Tissue specificity：Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colorectal tumors than in normal colon. Preferentially expressed in mucinous tumors and in some cases neuro-endocrine tumors. Expressed in mucus-secreting cells and enterocyte-like cells. In small intestine expressed at the basal perinuclear zone of goblet cells. {ECO:0000269|PubMed:11311942, ECO:0000269|PubMed:12455032, ECO:0000269|PubMed:12819006}.
Induction：Up-regulated by mucosal injury from active Crohn's disease or ulcerative colitis. Up-regulated in colorectal tumors. Up-regulated in epithelial cells at regenerating margins of peptic ulcers in the stomach and duodenum. {ECO:0000269|PubMed:11311942, ECO:0000269|PubMed:12455032, ECO:0000269|PubMed:12819006}.
Developmental stage：
Protein families：