CHMP5_HUMAN Q9NZZ3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NZZ3
Recommended name：Charged multivesicular body protein 5
EC number：
Alternative names：(Chromatin-modifying protein 5) (SNF7 domain-containing protein 2) (Vacuolar protein sorting-associated protein 60) (Vps60) (hVps60)
Cleaved into：
GeneID：51510
Gene names (primary )：CHMP5
Gene names (synonym )：C9orf83 SNF7DC2
Gene names (ORF )：CGI-34 HSPC177 PNAS-114 PNAS-2
Length：219
Mass：24571
Sequence：MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS
Tissue specificity：
Induction：Up-regulated by muramyl-dipeptide and lipopolysaccharide. {ECO:0000269|PubMed:27812135}.
Developmental stage：
Protein families：SNF7 family