DDT4L_HUMAN Q96D03
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96D03
Recommended name：DNA damage-inducible transcript 4-like protein
EC number：
Alternative names：(HIF-1 responsive protein RTP801-like) (Protein regulated in development and DNA damage response 2) (REDD-2)
Cleaved into：
GeneID：115265
Gene names (primary )：DDIT4L
Gene names (synonym )：REDD2 RTP801L
Gene names (ORF )：
Length：193
Mass：21740
Sequence：MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS
Tissue specificity：Up-regulated in atherosclerotic plaques relative to healthy segments of the same artery. {ECO:0000269|PubMed:15308555}.
Induction：Up-regulated by oxidized LDL and hypoxia in macrophages. {ECO:0000269|PubMed:15308555}.
Developmental stage：
Protein families：DDIT4 family