NUPR2_HUMAN A6NF83
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A6NF83
Recommended name：Nuclear protein 2
EC number：
Alternative names：(Nuclear transcriptional regulator 1-like protein) (Nuclear transcriptional regulator protein 2)
Cleaved into：
GeneID：389493
Gene names (primary )：NUPR2
Gene names (synonym )：NUPR1L
Gene names (ORF )：
Length：97
Mass：11356
Sequence：MEAPAERALPRLQALARPPPPISYEEELYDCLDYYYLRDFPACGAGRSKGRTRREQALRTNWPAPGGHERKVAQKLLNGQRKRRQRQLHPKMRTRLT
Tissue specificity：
Induction：Up-regulated by p53/TP53 in cancer cells (PubMed:25899918). Up-regulated by DNA damage stimulus or starvation (PubMed:25899918). {ECO:0000269|PubMed:25899918}.
Developmental stage：
Protein families：NUPR family