APR_HUMAN   Q13794


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q13794

Recommended name:Phorbol-12-myristate-13-acetate-induced protein 1

EC number:

Alternative names:(PMA-induced protein 1) (Immediate-early-response protein APR) (Protein Noxa)

Cleaved into:

GeneID:5366

Gene names  (primary ):PMAIP1

Gene names  (synonym ):NOXA

Gene names  (ORF ):

Length:54

Mass:6030

Sequence:MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT

Tissue specificity:Highly expressed in adult T-cell leukemia cell line.

Induction:Up-regulated by p53/TP53, phorbol esters, double-stranded RNA, IFNB1/IFN-beta and viruses. {ECO:0000269|PubMed:10807576, ECO:0000269|PubMed:15705586, ECO:0000269|PubMed:17374615}.

Developmental stage:

Protein families:PMAIP1 family


   💬 WhatsApp