BATF_HUMAN Q16520
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16520
Recommended name:Basic leucine zipper transcriptional factor ATF-like
EC number:
Alternative names:(B-cell-activating transcription factor) (B-ATF) (SF-HT-activated gene 2 protein) (SFA-2)
Cleaved into:
GeneID:10538
Gene names (primary ):BATF
Gene names (synonym ):
Gene names (ORF ):
Length:125
Mass:14120
Sequence:MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Tissue specificity:Expressed at highest levels in lung, and at lower levels in placenta, liver, kidney, spleen, and peripheral blood. Detected in SW480 colorectal cancer cell line and several hematopoietic tumor cell lines, including Raji Burkitt's lymphoma. Strongly expressed in mature B- and T-lymphocytes. Also expressed in moderate levels in lymph node and appendix and at low levels in thymus and bone marrow (PubMed:10777209). {ECO:0000269|PubMed:10777209, ECO:0000269|PubMed:8570175, ECO:0000269|PubMed:8630063}.
Induction:Up-regulated by PDCD1 following infection by HIV-1 virus, leading to inhibit T-cell functions and exhaust T-cells. Up-regulated by Epstein-Barr virus (EBV) protein EBNA2 following infection by EBV. {ECO:0000269|PubMed:12719594, ECO:0000269|PubMed:20890291}.
Developmental stage:
Protein families:BZIP family