IFNL4_HUMAN K9M1U5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:K9M1U5
Recommended name：Interferon lambda-4
EC number：
Alternative names：(IFN-lambda-4)
Cleaved into：
GeneID：101180976
Gene names (primary )：IFNL4
Gene names (synonym )：
Gene names (ORF )：
Length：179
Mass：19675
Sequence：MRPSVWAAVAAGLWVLCTVIAAAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDPPRPSSCARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKRRHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCL
Tissue specificity：
Induction：Up-regulated by polyinosinic:polycytidylic acid (polyI:C) which mimics the double-stranded hepatitis C virus. {ECO:0000269|PubMed:23291588}.
Developmental stage：
Protein families：Lambda interferon family