EMP2_HUMAN   P54851


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P54851

Recommended name:Epithelial membrane protein 2

EC number:

Alternative names:(EMP-2) (Protein XMP)

Cleaved into:

GeneID:2013

Gene names  (primary ):EMP2

Gene names  (synonym ):XMP

Gene names  (ORF ):

Length:167

Mass:19199

Sequence:MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK

Tissue specificity:Expressed in ciliary body epithelia, sclera, cornea, and retinal pigment epithelium (at protein level) (PubMed:12710941). {ECO:0000269|PubMed:12710941}.

Induction:Up-regulated by progesterone, increasing plasma membrane expression. {ECO:0000269|PubMed:18400107}.

Developmental stage:

Protein families:PMP-22/EMP/MP20 family


   💬 WhatsApp