FOLR2_HUMAN P14207
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P14207
Recommended name：Folate receptor beta
EC number：
Alternative names：(FR-beta) (Folate receptor 2) (Folate receptor, fetal/placental) (Placental folate-binding protein) (FBP)
Cleaved into：
GeneID：2350
Gene names (primary )：FOLR2
Gene names (synonym )：
Gene names (ORF )：
Length：255
Mass：29280
Sequence：MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQLWLLG
Tissue specificity：Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues. {ECO:0000269|PubMed:2605182, ECO:0000269|PubMed:8445646}.
Induction：Up-regulated by retinoic acid. {ECO:0000269|PubMed:20632143}.
Developmental stage：
Protein families：Folate receptor family