KLK14_HUMAN Q9P0G3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9P0G3
Recommended name:Kallikrein-14
EC number:EC:3.4.21.-
Alternative names:(hK14) (Kallikrein-like protein 6) (KLK-L6)
Cleaved into:
GeneID:43847
Gene names (primary ):KLK14
Gene names (synonym ):KLKL6
Gene names (ORF ):
Length:267
Mass:29122
Sequence:MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK
Tissue specificity:Highly expressed in CNS, bone marrow and fetal liver. Also expressed in breast, thyroid, kidney, colon, pancreas, spleen, prostate, uterus, small intestine, placenta and skeletal muscle. Among 40 tissues tested, the highest expression is detected in skin followed by breast and prostate (at protein level). Expressed in stratum corneum by sweat ducts and sweat glands and detected in sweat (at protein level). {ECO:0000269|PubMed:10969073, ECO:0000269|PubMed:11309303, ECO:0000269|PubMed:11352573, ECO:0000269|PubMed:16456535, ECO:0000269|PubMed:16800737, ECO:0000269|PubMed:17110383}.
Induction:Up-regulated by steroid hormone. {ECO:0000269|PubMed:12645335}.
Developmental stage:
Protein families:Peptidase S1 family, Kallikrein subfamily