TTP_HUMAN P26651
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P26651
Recommended name：mRNA decay activator protein ZFP36
EC number：
Alternative names：(G0/G1 switch regulatory protein 24) (Growth factor-inducible nuclear protein NUP475) (Tristetraprolin) (Zinc finger protein 36) (Zfp-36)
Cleaved into：
GeneID：7538
Gene names (primary )：ZFP36
Gene names (synonym )：G0S24 NUP475 RNF162A TIS11A TTP
Gene names (ORF )：
Length：326
Mass：34003
Sequence：MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
Tissue specificity：Expressed in both basal and suprabasal epidermal layers (PubMed:27182009). Expressed in epidermal keratinocytes (PubMed:27182009). Expressed strongly in mature dendritic cells (PubMed:18367721). Expressed in immature dendritic cells (at protein level) (PubMed:18367721). {ECO:0000269|PubMed:18367721, ECO:0000269|PubMed:27182009}.
Induction：Up-regulated by T cell activation (PubMed:15634918). Up-regulated in keratinocytes in response to wounding (PubMed:27182009). Up-regulated by lipopolysaccharide (LPS) in a p38 MAPK- and ERK-dependent manner (at protein level) (PubMed:15187101, PubMed:16508015). Up-regulated strongly during epidermal repair after wounding in keratinocytes (PubMed:20166898). Up-regulated strongly by epidermal growth factor (EGF) and tumor necrosis factor (TNF-alpha) in keratinocytes (PubMed:20166898). Up-regulated moderately by granulocyte macrophage colony-stimulating factor (GM-CSF) and fibroblast growth factor (FGF1) in keratinocytes (PubMed:20166898). Up-regulated also by glucocorticoid dexamethasone in keratinocytes (PubMed:20166898). Up-regulated in keratinocytes in response to wounding (PubMed:27182009). Up-regulated by LPS in a p38 MAPK-dependent manner (PubMed:14766228, PubMed:15187101). {ECO:0000269|PubMed:14766228, ECO:0000269|PubMed:15187101, ECO:0000269|PubMed:15634918, ECO:0000269|PubMed:16508015, ECO:0000269|PubMed:20166898, ECO:0000269|PubMed:27182009}.
Developmental stage：
Protein families：