SP30L_HUMAN Q9HAJ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9HAJ7
Recommended name：Histone deacetylase complex subunit SAP30L
EC number：
Alternative names：(HCV non-structural protein 4A-transactivated protein 2) (Sin3 corepressor complex subunit SAP30L) (Sin3-associated protein p30-like)
Cleaved into：
GeneID：79685
Gene names (primary )：SAP30L
Gene names (synonym )：NS4ATP2
Gene names (ORF )：
Length：183
Mass：20877
Sequence：MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE
Tissue specificity：Detected in brain and ovary, and at lower levels in heart, small intestine, lung, kidney, skeletal muscle, stomach and spleen (at protein level) (PubMed:18070604). Ubiquitous; expressed in all tissues tested with highest levels in testis (PubMed:14680513). {ECO:0000269|PubMed:14680513, ECO:0000269|PubMed:18070604}.
Induction：Up-regulated by TGFB1. {ECO:0000269|PubMed:14680513}.
Developmental stage：
Protein families：SAP30 family