UFM1_HUMAN P61960
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61960
Recommended name：Ubiquitin-fold modifier 1
EC number：
Alternative names：
Cleaved into：
GeneID：51569
Gene names (primary )：UFM1
Gene names (synonym )：C13orf20
Gene names (ORF )：BM-002
Length：85
Mass：9118
Sequence：MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
Tissue specificity：
Induction：Up-regulated by thapsigargin. {ECO:0000269|PubMed:23152784}.
Developmental stage：
Protein families：UFM1 family