BBC3_HUMAN Q9BXH1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BXH1
Recommended name：Bcl-2-binding component 3, isoforms 1/2
EC number：
Alternative names：(JFY-1) (p53 up-regulated modulator of apoptosis)
Cleaved into：
GeneID：27113
Gene names (primary )：BBC3
Gene names (synonym )：PUMA
Gene names (ORF )：
Length：193
Mass：20532
Sequence：MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
Tissue specificity：Ubiquitously expressed. {ECO:0000269|PubMed:11463391}.
Induction：Up-regulated by TP53 (PubMed:11463392). Up-regulated by DNA damage, glucocorticoid treatment, growth factor deprivation and TP53 (PubMed:11572983). Up-regulated by ER stress in a DDIT3/CHOP-dependent manner (PubMed:22761832). {ECO:0000269|PubMed:11463392, ECO:0000269|PubMed:11572983, ECO:0000269|PubMed:22761832}.
Developmental stage：
Protein families：Bcl-2 family