IFI27_HUMAN P40305
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P40305
Recommended name：Interferon alpha-inducible protein 27, mitochondrial
EC number：
Alternative names：(p27) (Interferon alpha-induced 11.5 kDa protein) (Interferon-stimulated gene 12a protein) (ISG12(a)) (ISG12A)
Cleaved into：
GeneID：3429
Gene names (primary )：IFI27
Gene names (synonym )：
Gene names (ORF )：
Length：122
Mass：11542
Sequence：MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
Tissue specificity：
Induction：Up-regulated by type-I and type-II interferons. {ECO:0000269|PubMed:14728724, ECO:0000269|PubMed:18330707, ECO:0000269|PubMed:22427340, ECO:0000269|PubMed:27777077}.
Developmental stage：
Protein families：IFI6/IFI27 family