IL20_HUMAN Q9NYY1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NYY1
Recommended name:Interleukin-20
EC number:
Alternative names:(IL-20) (Cytokine Zcyto10)
Cleaved into:
GeneID:50604
Gene names (primary ):IL20
Gene names (synonym ):ZCYTO10
Gene names (ORF ):UNQ852/PRO1801
Length:176
Mass:20072
Sequence:MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Tissue specificity:Expressed in most tissues and five major cell types: epithelial cells (primarily skin, buccal mucosa, tongue, nasal mucosa, lung, ureter, breast, prostate, fallopian tube, and adrenal gland), myoepithelial cells (mainly prostate), endothelial cells (mainly in small vessels or capillaries), macrophages, and skeletal muscle. Isoform 2 was detected in the lung tissue only. {ECO:0000269|PubMed:16908179}.
Induction:Up-regulated by UV-B irradiation in epithelial keratinocytes. {ECO:0000269|PubMed:16709143}.
Developmental stage:
Protein families:IL-10 family