CS012_HUMAN   Q9NSK7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NSK7

Recommended name:Protein C19orf12

EC number:

Alternative names:

Cleaved into:

GeneID:83636

Gene names  (primary ):C19orf12

Gene names  (synonym ):

Gene names  (ORF ):

Length:152

Mass:16286

Sequence:MERLKSHKPATMTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPPGLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQYDD

Tissue specificity:

Induction:Up-regulated during adipocyte differentiation in an in vitro preadipocyte differentiation model. {ECO:0000269|PubMed:21981780}.

Developmental stage:

Protein families:


   💬 WhatsApp