CS012_HUMAN Q9NSK7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NSK7
Recommended name：Protein C19orf12
EC number：
Alternative names：
Cleaved into：
GeneID：83636
Gene names (primary )：C19orf12
Gene names (synonym )：
Gene names (ORF )：
Length：152
Mass：16286
Sequence：MERLKSHKPATMTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPPGLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQYDD
Tissue specificity：
Induction：Up-regulated during adipocyte differentiation in an in vitro preadipocyte differentiation model. {ECO:0000269|PubMed:21981780}.
Developmental stage：
Protein families：