CF300_HUMAN   Q9BRQ4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BRQ4

Recommended name:Cilia- and flagella-associated protein 300

EC number:

Alternative names:

Cleaved into:

GeneID:85016

Gene names  (primary ):CFAP300

Gene names  (synonym ):C11orf70

Gene names  (ORF ):

Length:267

Mass:30859

Sequence:MATGELGDLGGYYFRFLPQKTFQSLSSKEITSRLRQWSMLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS

Tissue specificity:Expressed in nasal epithelial cells. {ECO:0000269|PubMed:29727693}.

Induction:Up-regulated during ciliogenesis. {ECO:0000269|PubMed:29727692, ECO:0000269|PubMed:29727693}.

Developmental stage:

Protein families:CFAP300 family


   💬 WhatsApp