CLC7A_HUMAN Q9BXN2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BXN2
Recommended name：C-type lectin domain family 7 member A
EC number：
Alternative names：(Beta-glucan receptor) (C-type lectin superfamily member 12) (Dendritic cell-associated C-type lectin 1) (DC-associated C-type lectin 1) (Dectin-1) (CD antigen CD369)
Cleaved into：
GeneID：64581
Gene names (primary )：CLEC7A
Gene names (synonym )：BGR CLECSF12 DECTIN1
Gene names (ORF )：UNQ539/PRO1082
Length：247
Mass：27627
Sequence：MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
Tissue specificity：Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta. {ECO:0000269|PubMed:11470510, ECO:0000269|PubMed:11491532, ECO:0000269|PubMed:11567029, ECO:0000269|PubMed:11745369, ECO:0000269|PubMed:12423684}.
Induction：Up-regulated during differentiation from monocytes into dendritic cells. {ECO:0000269|PubMed:12423684}.
Developmental stage：
Protein families：