BRI3_HUMAN   O95415


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O95415

Recommended name:Brain protein I3

EC number:

Alternative names:(pRGR2)

Cleaved into:

GeneID:25798

Gene names  (primary ):BRI3

Gene names  (synonym ):

Gene names  (ORF ):

Length:125

Mass:13645

Sequence:MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA

Tissue specificity:

Induction:Up-regulated during TNF-mediated inflammation and immunity (By similarity). Up-regulated by beta-catenin and TCF4 (PubMed:20538055). {ECO:0000250|UniProtKB:P28662, ECO:0000269|PubMed:20538055}.

Developmental stage:

Protein families:BRI3 family


   💬 WhatsApp