CEAM6_HUMAN P40199
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P40199
Recommended name：Carcinoembryonic antigen-related cell adhesion molecule 6
EC number：
Alternative names：(Non-specific crossreacting antigen) (Normal cross-reacting antigen) (CD antigen CD66c)
Cleaved into：
GeneID：4680
Gene names (primary )：CEACAM6
Gene names (synonym )：NCA
Gene names (ORF )：
Length：344
Mass：37195
Sequence：MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Tissue specificity：Expressed in neutrophils (PubMed:1378450). Expressed in columnar epithelial and goblet cells of the colon (PubMed:10436421). Expressed in numerous tumor cell lines (at protein level) (PubMed:16204051). {ECO:0000269|PubMed:10436421, ECO:0000269|PubMed:1378450, ECO:0000269|PubMed:16204051}.
Induction：Up-regulated in anoikis-resistant pancreatic adenocarcinoma cells (at protein level). {ECO:0000269|PubMed:14724575}.
Developmental stage：
Protein families：Immunoglobulin superfamily, CEA family