RHNO1_HUMAN Q9BSD3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BSD3
Recommended name：RAD9, HUS1, RAD1-interacting nuclear orphan protein 1
EC number：
Alternative names：(RAD9, RAD1, HUS1-interacting nuclear orphan protein)
Cleaved into：
GeneID：83695
Gene names (primary )：RHNO1
Gene names (synonym )：C12orf32 RHINO
Gene names (ORF )：HKMT1188
Length：238
Mass：26709
Sequence：MPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPDFDTAAGSLFPAYQKHQNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESEKDVSRRPLVPVLSPQSCGNMSVQALQSLPYVFIPPDIQTPESSSVKEELIPQDQKENSLLSCTLHTGTPNSPEPGPVLVKDTPEDKYGIKVTWRRRQHLLAYLRERGKLSRSQFLVKS
Tissue specificity：Weakly expressed in testis, prostate, ovary, thymus and small intestine. Expressed strongly in breast cancer cells. {ECO:0000269|PubMed:20811708}.
Induction：Up-regulated in breast cancer cells. {ECO:0000269|PubMed:20811708}.
Developmental stage：
Protein families：