RNAS6_HUMAN Q93091
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q93091
Recommended name:Ribonuclease K6
EC number:EC:3.1.27.-
Alternative names:(RNase K6)
Cleaved into:
GeneID:6039
Gene names (primary ):RNASE6
Gene names (synonym ):RNS6
Gene names (ORF ):
Length:150
Mass:17196
Sequence:MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL
Tissue specificity:Highly expressed in spleen (at protein level) (PubMed:8836175, PubMed:25075772). Has little or no expression in healthy kidneys (at protein level) (PubMed:25075772). Detected in interstitial leukocytes in infected kidneys (at protein level) (PubMed:25075772). Expressed in ureter where it localizes to urothelial and submucosal leukocytes (at protein level) (PubMed:25075772). Strong expression in lung and thymus, and lower expression in heart, placenta, pancreas, liver, brain and skeletal muscle (PubMed:8836175, PubMed:25075772). Also expressed in monocytes and neutrophils (PubMed:8836175). {ECO:0000269|PubMed:25075772, ECO:0000269|PubMed:8836175}.
Induction:Up-regulated in CD14+ monocytes in response to the uropathogenic E.coli strain CFT073. {ECO:0000269|PubMed:25075772}.
Developmental stage:
Protein families:Pancreatic ribonuclease family