UB2V2_HUMAN   Q15819


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15819

Recommended name:Ubiquitin-conjugating enzyme E2 variant 2

EC number:

Alternative names:(DDVit 1) (Enterocyte differentiation-associated factor 1) (EDAF-1) (Enterocyte differentiation-promoting factor 1) (EDPF-1) (MMS2 homolog) (Vitamin D3-inducible protein)

Cleaved into:

GeneID:7336

Gene names  (primary ):UBE2V2

Gene names  (synonym ):MMS2 UEV2

Gene names  (ORF ):

Length:145

Mass:16363

Sequence:MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

Tissue specificity:Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues. {ECO:0000269|PubMed:9199207, ECO:0000269|PubMed:9705497}.

Induction:Up-regulated in cultured fresh blood cells upon treatment with vitamin D3. {ECO:0000269|PubMed:9199207}.

Developmental stage:

Protein families:Ubiquitin-conjugating enzyme family


   💬 WhatsApp