T176B_HUMAN Q3YBM2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3YBM2
Recommended name：Transmembrane protein 176B
EC number：
Alternative names：(Protein LR8)
Cleaved into：
GeneID：28959
Gene names (primary )：TMEM176B
Gene names (synonym )：LR8
Gene names (ORF )：
Length：270
Mass：29056
Sequence：MTQNTVIVNGVAMASRPSQPTHVNVHIHQESALTQLLKAGGSLKKFLFHPGDTVPSTARIGYEQLALGVTQILLGVVSCVLGVCLSLGPWTVLSASGCAFWAGSVVIAAGAGAIVHEKHPGKLAGYISSLLTLAGFATAMAAVVLCVNSFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRALFLAVCVLKVIVSLVSLGVGLRNLCGQSSQPLNEEGSEKRLLGENSVPPSPSREQTSTAIVL
Tissue specificity：Expressed in lung and dermal fibroblasts. {ECO:0000269|PubMed:9922225}.
Induction：Up-regulated in fibrotic lung. Down-regulated in activated dendritic cells. {ECO:0000269|PubMed:16095493, ECO:0000269|PubMed:9922225}.
Developmental stage：
Protein families：TMEM176 family